Protein Info for Psyr_3696 in Pseudomonas syringae pv. syringae B728a

Annotation: 23S rRNA m(5)U-1939 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF01938: TRAM" amino acids 24 to 75 (52 residues), 35.8 bits, see alignment 1.2e-12 TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA" amino acids 272 to 442 (171 residues), 195 bits, see alignment E=1.1e-61 PF05958: tRNA_U5-meth_tr" amino acids 279 to 447 (169 residues), 86.7 bits, see alignment E=3.3e-28 PF13847: Methyltransf_31" amino acids 304 to 381 (78 residues), 33.3 bits, see alignment E=8.2e-12 PF13649: Methyltransf_25" amino acids 308 to 367 (60 residues), 28.2 bits, see alignment E=5.1e-10

Best Hits

Swiss-Prot: 100% identical to RLMD_PSEU2: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to psb:Psyr_3696)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ44 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Psyr_3696 23S rRNA m(5)U-1939 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MAKHERGLRFQPAGGVKTVQIPAGKKQRLTIERLSDDGRGIAFLEGKTWFVAGSLAGEEV
EARVLNARGKVVEARTERVFTASAMRRAPACEYFGRCGGCSVQHVPHEEQLALKQRMLAE
QLLRVANVVPDEWAAPLSGAELAYRRRARVAVRWDAKAKRLDVGFRAAASQDIVSIEHCP
VLVQALQPIMNELPGMLKSFSKPQVLGHVELFSGVATAVLLRHTASLVEADLALLQAFCS
RHGAQLWLHGEGEPQPASPGDTLGYRLEPWNLQLAWRPGDFIQVNASVNTAMIEQALQWL
APAKDERVMDLFCGLGNFALPLAGLARDVVAVEGVATMVERAAVNAMSNDLHNVRFFQAD
LSQPLTQADWAAEGFSAVLLDPPRDGAFEVVRQIRKTGARRLLYVSCNPATLARDAVELI
RQGYRLKRAGILDMFPQTAHVEAMALFEMSK