Protein Info for Psyr_3690 in Pseudomonas syringae pv. syringae B728a

Annotation: formyltetrahydrofolate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR00639: phosphoribosylglycinamide formyltransferase" amino acids 6 to 193 (188 residues), 243.3 bits, see alignment E=7e-77 PF00551: Formyl_trans_N" amino acids 7 to 185 (179 residues), 206.8 bits, see alignment E=1.2e-65

Best Hits

Swiss-Prot: 60% identical to PUR3_ECOLI: Phosphoribosylglycinamide formyltransferase (purN) from Escherichia coli (strain K12)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 100% identity to psb:Psyr_3690)

MetaCyc: 60% identical to phosphoribosylglycinamide formyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Phosphoribosylglycinamide formyltransferase. [EC: 2.1.2.2]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ50 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Psyr_3690 formyltetrahydrofolate-dependent phosphoribosylglycinamide formyltransferase (Pseudomonas syringae pv. syringae B728a)
MPAICEVVVLLSGTGGNLQAMIDSFKDGASPVRIRAVISNRADAFGLQRAQDAGIETCVL
DHTAYDGREAFDAALIERIDAFQPQLVVLAGFMRILSAGFVRHYHGRLLNIHPSLLPRYK
GLHTHKRALEAGDAEHGCSVHFVTEELDGGPLVVQAVISVQLHDTPATLAQRVHVQEHRI
YPLAIRWFAEGRLSLGEQGALLDSQLLPASGHLIRH