Protein Info for Psyr_3644 in Pseudomonas syringae pv. syringae B728a

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF03807: F420_oxidored" amino acids 17 to 106 (90 residues), 28.7 bits, see alignment E=3.4e-10 PF02153: PDH_N" amino acids 29 to 183 (155 residues), 127.3 bits, see alignment E=7.7e-41 PF20463: PDH_C" amino acids 189 to 285 (97 residues), 96.9 bits, see alignment E=1.6e-31 PF00275: EPSP_synthase" amino acids 314 to 518 (205 residues), 86.5 bits, see alignment E=3.2e-28

Best Hits

KEGG orthology group: K00210, prephenate dehydrogenase [EC: 1.3.1.12] K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 100% identity to psb:Psyr_3644)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43) / 5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43, EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.19

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43 or 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ96 at UniProt or InterPro

Protein Sequence (534 amino acids)

>Psyr_3644 prephenate dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MVDVIAEQSVRPLIGRLVVVGLGLIGGSFAKGVRESGLCREVVGVDLDPQSRQLAVELGV
VDRCEADLAVACRGADVIQLAVPILAMEKLLALLAPIDLGQAILTDVGSAKGNVVRAARQ
AFGHMPSRFVPGHPIAGSEQSGVEASNAALFRRHKVILTPLAETDPHAVAIVDQLWSALG
ADVEHMQVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLDIFRYAAGGFRDFTRIAGSD
PTMWHDIFMANRDAVLRTLDSFRTDLDALRDAVDAGDGAQLMDVFTRARAAREHFGRILA
SRARVDSSVGEPRAIHGGAAEGVSHRIKGPVDVTSAVLFMVATSISEGCDLLLEDVSVSS
SCEGAIDILRLMGGDIVLQNVRKLADETVADLHVRSARLKGADIPEALVPLALNAFPVLL
VAAACAEGRTILRGAQALQADEAECVRLMADGLLAVGIEVESVLDGIIIEGGVPGGGEVD
ARGDQRIVMAFRVASLRASAPIRIQACADAAALFPHFLALCAQVGMRVAQEDKK