Protein Info for Psyr_3637 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 76 to 228 (153 residues), 122.6 bits, see alignment E=8.2e-40

Best Hits

KEGG orthology group: K13007, Fuc2NAc and GlcNAc transferase [EC: 2.4.1.-] (inferred from 100% identity to psb:Psyr_3637)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.7.8.-

Use Curated BLAST to search for 2.4.1.- or 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQA3 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psyr_3637 Glycosyl transferase, family 4 (Pseudomonas syringae pv. syringae B728a)
MIEWLSVIAIAFLSLILTALLRKYALAKSLIDIPNARSSHSMPTPRGGGVAIVITFIMAM
AVLGWAGHLPSSALVAIVGSGGLVAVIGFMDDHGHIAARWRLLGHFAAAAWALFWLGGLA
PLEFMGWTFDAGPLWQVLAAFYLVWMLNLYNFMDGIDGIAGIEAVTVCLGMSIIYALSGH
AGLSWEVLMLGAAAAGFLYWNFPPAKIFMGDAGSGFLGIALGVLSIQGSWASPQLFWSWL
ILLGVFIVDATVTLVRRLLRRERPYEAHRSHAYQFASRHYGRHVPVTLAVGLINLVWLLP
IALWVALGDGEGLIWAVVAYSPLILLALKFHAGKAE