Protein Info for Psyr_3614 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 TIGR00357: methionine-R-sulfoxide reductase" amino acids 6 to 130 (125 residues), 195.4 bits, see alignment E=1.8e-62 PF01641: SelR" amino acids 15 to 128 (114 residues), 178.7 bits, see alignment E=1.7e-57

Best Hits

Swiss-Prot: 100% identical to MSRB_PSEU2: Peptide methionine sulfoxide reductase MsrB (msrB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to psb:Psyr_3614)

MetaCyc: 57% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQC6 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Psyr_3614 Protein of unknown function DUF25 (Pseudomonas syringae pv. syringae B728a)
MDKLQKTLEEWKQMLDPEQYNVCRLKGTERPFSGKYDKVKTDGIYHCICCDEPLFDSTTK
FDSGCGWPSFYAPLENSAVIEVRDMSHGMIRTEVVCAKCDAHLGHVFPDGPPPTGLRYCI
NSVCLDLVPRS