Protein Info for Psyr_3592 in Pseudomonas syringae pv. syringae B728a

Annotation: Nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 112 to 133 (22 residues), see Phobius details PF00881: Nitroreductase" amino acids 10 to 163 (154 residues), 66.5 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 43% identical to YDJA_ECO57: Putative NAD(P)H nitroreductase YdjA (ydjA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3592)

Predicted SEED Role

"Nitroreductase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQE8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Psyr_3592 Nitroreductase (Pseudomonas syringae pv. syringae B728a)
MQALDVLLNRVSVPRLVDPAPDAAQREILFGAALRAPDHGQLKPYRFLTVEGAARERMGE
MLAQALQESGAEVTPQALEKARLGPFRAPLVVVVIARLQDHFKVPHSEQRITAGCAAHGV
LLAAYALGIGAVWRTGELSYAPQVAKGFGLEAGEEVLGFLYLGTPLNPPREAPKVDTGGF
VSEWQG