Protein Info for Psyr_3504 in Pseudomonas syringae pv. syringae B728a

Annotation: GAF:ATP-binding region, ATPase-like:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 PF08446: PAS_2" amino acids 16 to 119 (104 residues), 94.9 bits, see alignment E=1.3e-30 PF01590: GAF" amino acids 148 to 311 (164 residues), 51.3 bits, see alignment E=4.6e-17 PF00360: PHY" amino acids 331 to 503 (173 residues), 131.4 bits, see alignment E=6.5e-42 PF00512: HisKA" amino acids 520 to 591 (72 residues), 55.2 bits, see alignment E=1.5e-18 PF02518: HATPase_c" amino acids 637 to 744 (108 residues), 101 bits, see alignment E=1.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3504)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQN6 at UniProt or InterPro

Protein Sequence (745 amino acids)

>Psyr_3504 GAF:ATP-binding region, ATPase-like:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MSQLDKDAFEVLLANCADEPIQFPGAIQPHGLLFTLAEPELTILQVSANVQTVLGHVPEQ
LLGKGLDCVLGAGWAEVIRSASAHDSFIDAQRLLMSINGIEFEALLHRHQGVLVLELEIQ
GKDAQSVSYSERTGNMGRMLRQLHAASDLQTLYEVSVREIQKMTGYDRVLIYRFEEEGHG
QVIAEASAPSMELFNGLFFPASDIPEQARELYRRNWLRIIPDADYIPVPLVPQLRPDTQQ
QLDLSFSTLRSVSPIHCQYMKNMGVLSSMSVSLIQSGKLWGLISCGNRTPLYVSHELRSA
CQAIGQVLSLQISAMEALEISRQREAKVRALEQLNLAMAGSEENVFDGLAQQPQLLMDLV
GATGVAIIEDRQTHCFGICPEPSDIRALHAWMIAGGEPVYASHHLSSVYAPAEAYQPVAS
GVLAMSLPKPVDNGVIWFRPEVKETVQWSGDPKKPLNMESSAGGMRLRPRTSFEIWKVEM
TGIATKWSYGDVFAANDLRRSALENDLARQVRREQQAVRARDELVAVVSHDLRNPMTVIS
MLCGMMQKSFSSDGPHTSRRISTAIDTMQQAASRMNVLLEDLLDTSKIEAGRYTITPQPL
EVSQIFEEAYTLLAPLAMDKSIEISFNAEPDLKVQADPERLFQVLSNLIGNAIKFTPKMG
TIGVAAMSNGTEIVFTVRDSGEGIPPEQLPHIFERYWTVKEGNPTGTGLGLYISQGIIKA
HGGELAAQSQVGEGSEFRFTVPMAV