Protein Info for Psyr_3496 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat:Response regulator receiver:Response regulator receiver:Response regulator receiver

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF00072: Response_reg" amino acids 10 to 124 (115 residues), 68.3 bits, see alignment E=3.3e-22 PF07721: TPR_4" amino acids 198 to 223 (26 residues), 13.8 bits, see alignment (E = 4e-05) PF13181: TPR_8" amino acids 200 to 229 (30 residues), 18.8 bits, see alignment (E = 6.9e-07) PF13432: TPR_16" amino acids 203 to 263 (61 residues), 25.6 bits, see alignment E=6.8e-09 amino acids 238 to 296 (59 residues), 23.2 bits, see alignment 3.7e-08 PF14559: TPR_19" amino acids 208 to 273 (66 residues), 32 bits, see alignment E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3496)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQP4 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Psyr_3496 TPR repeat:Response regulator receiver:Response regulator receiver:Response regulator receiver (Pseudomonas syringae pv. syringae B728a)
MLAYNQKSFLIVDDFSDFRSSVRSMLRELGVKEVDTADTGEQALRMCSQKRYDFVLHDFN
LGDGRKNGQQVLEDLMIERLLSYESVFIMVTAENSQAMVMSALEWEPDGYLTKPFNRAGL
AQRLEKLVQRKTLLKPILQALDRRKPAEVLAACDKLIEQDPRYAPLCLRYKADALRDLKQ
NEPLEAFLKTILADRATPWAYGALGSLLLKRGKTAEAQAVYEQAIKAFPTMPALFDGLAD
VLVALGDGKRAQSVLESAVRLSPLAVRRQKLLGKLALGNEDFESASKAYRQAVSQGQHSR
FKDPETNLGLAHALISKGGDQGLDARTRVEINNALVDVAKEHGDDQGLQVRTRLMKAASL
QHSDPEAAAKLTEQAMARLDGMEQVLSADAALMVAAQLKQLGQEEAGAGVLKSCAGAYGD
DPAVMKSIASMTDDPAILGASKAAVDFNLQGVRSYKAGNLTEAQAFFRSALGLQPKNISI
VLNMVQSLLHPGQDLGQAGIDECRASLTMLGKIPESDPRYERYHKLRERAFSA