Protein Info for Psyr_3485 in Pseudomonas syringae pv. syringae B728a

Annotation: MCP methyltransferase, CheR-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF03705: CheR_N" amino acids 12 to 63 (52 residues), 44.5 bits, see alignment 1.5e-15 PF01739: CheR" amino acids 78 to 272 (195 residues), 202.6 bits, see alignment E=6.8e-64 PF08241: Methyltransf_11" amino acids 200 to 253 (54 residues), 21.4 bits, see alignment E=5e-08

Best Hits

Swiss-Prot: 88% identical to CHER2_PSEPK: Chemotaxis protein methyltransferase Cher2 (cheR2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to psb:Psyr_3485)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQQ5 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psyr_3485 MCP methyltransferase, CheR-type (Pseudomonas syringae pv. syringae B728a)
MRGGTLSTGNLDFDQFRVFLEKACGILLGENKQYLVSSRLNKLMEQQSIKSLGELVQRIQ
TQPRSGLREQVVDAMTTNETLWFRDTYPFEVLKNKVLPEQIKASPGQRLRIWSAACSSGQ
EPYSLSMSIDEFERANQGQLKSGVQIVATDLSGLMLNNCKTGEYDSLAIGRGLSPDRLQR
FFDVKSPGRWVVKAPIKSRVEFRSFNLLDSYASLGKFDIVFCRNVLIYFSAEVKKDILLR
IHGTLKPGGYLFLGASEALNGLPDHYQMVQCSPGIIYKAK