Protein Info for Psyr_3477 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar basal body rod protein:Protein of unknown function DUF1078:Flagellar basal body FlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 246 (246 residues), 144.9 bits, see alignment E=2.6e-46 amino acids 308 to 564 (257 residues), 133.3 bits, see alignment E=8.8e-43 PF00460: Flg_bb_rod" amino acids 3 to 33 (31 residues), 26.9 bits, see alignment (E = 7.3e-10) PF22692: LlgE_F_G_D1" amino acids 85 to 145 (61 residues), 40.8 bits, see alignment E=4e-14 PF07559: FlgE_D2" amino acids 162 to 276 (115 residues), 40 bits, see alignment E=1.1e-13 amino acids 315 to 463 (149 residues), 82.4 bits, see alignment E=9.4e-27 PF06429: Flg_bbr_C" amino acids 537 to 580 (44 residues), 50.1 bits, see alignment 3.1e-17

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to psb:Psyr_3477)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQR3 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Psyr_3477 Flagellar basal body rod protein:Protein of unknown function DUF1078:Flagellar basal body FlaE (Pseudomonas syringae pv. syringae B728a)
MSFNTAISGIHAANKRLEVAGNNIANVGTLGFKSSRAQFSALYASAQLGAGQHAVGDGVR
LASVQQNFNQGETVISSGNALDMRIQGNGFFVVSDQGSLAYTRAGAFLKDAANFVVDSDG
GRLQGYAANDKGEIASGIRTDLQIDTSNVGARATTTVAETINLDASLPSLARLPTFDPAD
PATFTRVATRTIQDVGITPVPAADHELKQYFVKTEANQWSMYVLVDGRNPVDPDSVAPLQ
VSLELKPDGSLSYSGNDQHLSKVSDTEFALQGWVPATQINGAWAANGSLNGGAVSLPLSD
AGASLLDPGDTVMHRPVPDFNPADLNTYSRMFGNQIFDSQGNTHELKQYFVKDGTNSWRM
HVLIDDRNPQNSASTTPLTANIVFDSHGTVASLTGSPGLSSSNGNQLKLTGWSPVMAVDP
GTSRERWIANGAAGSADGITIDFTHLLQHNAASSRSAAYVDGHSAGELKSLDVGRDGILR
AGFTNGMTKDIGQVMLASFANPHGLQPRSDTRWTATADSGVAEYDVPGVGTLGSIVSGAL
EGSNVVLADELIALIQAQTAYQANSKAISTEVTLMQTLIQST