Protein Info for Psyr_3473 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar P-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02119: FlgI" amino acids 24 to 368 (345 residues), 480.9 bits, see alignment E=9.5e-149

Best Hits

Swiss-Prot: 100% identical to FLGI_PSEU2: Flagellar P-ring protein (flgI) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 99% identity to pst:PSPTO_1942)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQR7 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Psyr_3473 Flagellar P-ring protein (Pseudomonas syringae pv. syringae B728a)
MIKLKQLIAATLLLSTAFGVHAERLKDIASISGVRANQLIGYGLVVGLNGTGDQTTQTPF
TLQTFNNMLSQFGIKVPAGSGTVQLKNVAAVAVYADLPAFAKPGQTVDITVSSIGNSKSL
RGGALLMTPMKGVDGNVYAIAQGNLVVGGFDAEGRDGSKITVNVPSSGRIPGGASVERSV
PSGFNQGNTLTLNLNRSDFTTAKRIVDKINELLGPGVAQALDGGSVRVTAPLDPGQRVDY
LSILENLEVDPGQTAAKVIINSRTGTIVIGQNVKVSPAAVTHGSLTVTITEDPIVSQPGA
LSGGQTAVVPRSRVNAQQELHPMFKFGPGTTLDEIVRAVNQVGAAPGDLMAILEALKQAG
ALQADLIVI