Protein Info for Psyr_3442 in Pseudomonas syringae pv. syringae B728a

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 124 to 154 (31 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 16 to 257 (242 residues), 259.5 bits, see alignment E=1.6e-81 PF01311: Bac_export_1" amino acids 17 to 246 (230 residues), 228.3 bits, see alignment E=4.9e-72

Best Hits

Swiss-Prot: 41% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to psb:Psyr_3442)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQU8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Psyr_3442 Flagellar biosynthesis protein FliR (Pseudomonas syringae pv. syringae B728a)
MQPMLALTDTQISTWVASFMLPLFRIIALLMTMPIIGTTLVPRRVRMYLAVAITVVVAPA
LPAMPPVQALDLSALLLIGEQIIIGAGMGLSLQLFFHIFVIAGQIISTQMGMGFASMVDP
TNGVSSATIGQFFTMLVTLLFLAMNGHLVVLEVLVESFTTMPVGSGLLVNNFWELANGLG
WVLASGLRLVLPAITALLIINIAFGVMTRAAPQLNIFSIGFPLTLVLGMVILWMTMGDML
NQYQPIATQALQALRDMVRAR