Protein Info for Psyr_3420 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details PF05751: FixH" amino acids 12 to 155 (144 residues), 112.1 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: K09926, hypothetical protein (inferred from 100% identity to psb:Psyr_3420)

Predicted SEED Role

"Putative analog of CcoH, COG3198" in subsystem Biogenesis of cbb3-type cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQX0 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Psyr_3420 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MPAATAASPWYRHLWPWIIIAILTGSVTLSLSMVFIAVTHPDPLVTDNYYEAGKGINRSL
NREVLAQTLKLHARLHMDELTGEVELRLSGNSNPERLELNLISPTRPDSDRRVFLTRSPS
EPGRYIGQLQDKVNGRRFVELLGVEGEQTWRLFEEEQIGTDDVTLGDEPLQAAQRRKD