Protein Info for Psyr_3393 in Pseudomonas syringae pv. syringae B728a

Annotation: Heme exporter protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 8 to 209 (202 residues), 249.4 bits, see alignment E=1.2e-78 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 103.8 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 100% identical to CCMA_PSEU2: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to psb:Psyr_3393)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQZ7 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psyr_3393 Heme exporter protein CcmA (Pseudomonas syringae pv. syringae B728a)
MIPATPFLQATALACERDGRMLFENLDLHLHTGDMLQISGPNGCGKTSLLRLLCGLMQPT
AGQILLDAQPLGRQPAAPGRKPLWIGHAPAIKDVLTPLENLSWLSALHQPDGADADTIAT
ALDAVGLAGFEDVPCHTLSAGQQRRVALARLYLPGPPLWLLDEPFTALDRQGIEQLEKHL
AEHCEHGGMIVMTTHHSLNRLPAGYRDLDLGQWSA