Protein Info for Psyr_3367 in Pseudomonas syringae pv. syringae B728a

Annotation: Iron permease FTR1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details PF03239: FTR1" amino acids 1 to 263 (263 residues), 217.6 bits, see alignment E=1.2e-68

Best Hits

Swiss-Prot: 59% identical to EFEU_YERPN: Ferrous iron permease EfeU (efeU) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to psb:Psyr_3367)

Predicted SEED Role

"Ferrous iron transport permease EfeU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR23 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Psyr_3367 Iron permease FTR1 (Pseudomonas syringae pv. syringae B728a)
MLVPFLIMLREGIEAALIVGIIASYLKQTGRGEWMPAVWIGVFLAVALSLFVGGGLELMS
AEFPQKQQELFEGIVGLIAVGILSSMVFWMRKVARSIKHALHESLDAALTGSKNQTYALI
AMVFFAVAREGLETVFFLLAVFQQSEGSGAPLGALLGLLLAVGFGVAIYSGSMRLNLSLF
FRWTGLFILVVAAGILANSVQALHEAGVWNHLQEVVFDISARLPMDGPAGSVLAGMFGYQ
DAPTVSTLSAYLIYLIGALLLFFKPHTPTAGKVMQPNTSSVTNE