Protein Info for Psyr_3365 in Pseudomonas syringae pv. syringae B728a

Annotation: Transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF02805: Ada_Zn_binding" amino acids 36 to 95 (60 residues), 78.3 bits, see alignment E=8.5e-26 PF00165: HTH_AraC" amino acids 125 to 156 (32 residues), 34.8 bits, see alignment (E = 3.4e-12) PF12833: HTH_18" amino acids 130 to 207 (78 residues), 55.2 bits, see alignment E=1.8e-18 PF02870: Methyltransf_1N" amino acids 215 to 289 (75 residues), 21.6 bits, see alignment E=6.8e-08 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 294 to 373 (80 residues), 112.9 bits, see alignment E=2.9e-37 PF01035: DNA_binding_1" amino acids 296 to 374 (79 residues), 119.7 bits, see alignment E=9.7e-39

Best Hits

Swiss-Prot: 48% identical to ADA_ECOLI: Bifunctional transcriptional activator/DNA repair enzyme Ada (ada) from Escherichia coli (strain K12)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 100% identity to psb:Psyr_3365)

MetaCyc: 48% identical to DNA-binding transcriptional dual regulator / DNA repair protein Ada (Escherichia coli K-12 substr. MG1655)
2.1.1.M37 [EC: 2.1.1.M37]; Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.M37, 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.M37, 2.1.1.63]

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.63 or 2.1.1.M37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR25 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Psyr_3365 Transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase (Pseudomonas syringae pv. syringae B728a)
MAPTGAGLSKLKAGSTMDSTEGTQTARALRTEDDPRWDILVNRRSHAGADFVYGVLTTGI
YCKPCSPTRLPRPENVVFFDSAHDAEAAGFRPSLRNAGDSNALQRKHAEVVAQACRLIDA
ADSMLNLTALAEQVGISGFHFHRIFKRLTGLTPRAYSVASLRSRVKVQLSQSVSITHALY
EAGYNANSRFYEASQDMLGMKPSEYRAGGANVDIRFALGESSLGSILVATSSKGICAISL
GDDPHALIEAFQDQFPNANLIGADAAFEQLVAEVVGFVESPATGLALPLDIRGTVFQERV
WQALRDIPAGSTATYTQIATQIGLPSAVRAVANACGANKLAVAIPCHRVVRSDGSLSGYR
WGVERKRKLLEIEAAEGAGLFSGR