Protein Info for Psyr_3277 in Pseudomonas syringae pv. syringae B728a

Annotation: Phospholipase D/Transphosphatidylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 357 to 380 (24 residues), see Phobius details PF13091: PLDc_2" amino acids 29 to 137 (109 residues), 41 bits, see alignment E=1.6e-14 amino acids 212 to 336 (125 residues), 101.3 bits, see alignment E=3.9e-33 PF00614: PLDc" amino acids 112 to 134 (23 residues), 27.3 bits, see alignment (E = 2.8e-10)

Best Hits

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to psb:Psyr_3277)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRB3 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Psyr_3277 Phospholipase D/Transphosphatidylase (Pseudomonas syringae pv. syringae B728a)
MSNTTGQWRDGNSVELLINGEDFYARVFECIRAARKEVLIETFIIFEDRIGESLQQALLE
AAANGAKVVVTVDDYGTSDLSSTFVKTMIDAGIQIQLFDPRPRFMGMRTNLFRRLHRKVV
VIDGELGFIGGINYSVDHMTDTGLTAKQDYAVLVRGPIVGDIHHSALNMLSKVVRDKLPP
IALKLDRAGDASMLLAERDNDEHSTDIEEQYLEAIRAAKQRITLANAYFYPSYRFLRELR
NASRRGVKVTLILQGQPDMPFVRVCSRLTYTYLLRDGVAIHEYKQRALHGKVALIDQDWS
TVGSSNLDPLSLALNLEANLFIRDRTLNEHLQNHLMELAAAHSKQMSLKGAARGQWWRAP
MIVLSFFFLRRFPAIAGLFPVHGVRLKPLRAGDVVPEAKVIEQQQNNHPMDQEKTL