Protein Info for Psyr_3255 in Pseudomonas syringae pv. syringae B728a

Annotation: multisubunit potassium/proton antiporter, PhaE subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 67 to 83 (17 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details PF01899: MNHE" amino acids 12 to 160 (149 residues), 131.1 bits, see alignment E=1.4e-42

Best Hits

Swiss-Prot: 41% identical to PHAE_RHIME: Probable K(+)/H(+) antiporter subunit E (phaE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05562, multicomponent K+:H+ antiporter subunit E (inferred from 100% identity to psb:Psyr_3255)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRD5 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Psyr_3255 multisubunit potassium/proton antiporter, PhaE subunit (Pseudomonas syringae pv. syringae B728a)
MKRLFPAPLLSLALWLLWLVLNLSISPGHLLLGAVLGFLAPILMAPLRPLPVRIRKPGTI
LKFLWRVGRDVVVSNVQVGLSVWRLESRPPRSAFVRIPLDLHDAHGLAALAMVTTVVPGT
VWSELALDRSVLLMHVFDLEDEAQFIEHFKTTYERPLMEIFQ