Protein Info for Psyr_3254 in Pseudomonas syringae pv. syringae B728a

Annotation: multisubunit potassium/proton antiporter, PhaD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 76 to 105 (30 residues), see Phobius details amino acids 123 to 153 (31 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details amino acids 458 to 479 (22 residues), see Phobius details amino acids 500 to 517 (18 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 134 to 442 (309 residues), 90.3 bits, see alignment E=6.8e-30

Best Hits

KEGG orthology group: K05561, multicomponent K+:H+ antiporter subunit D (inferred from 100% identity to psb:Psyr_3254)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRD6 at UniProt or InterPro

Protein Sequence (561 amino acids)

>Psyr_3254 multisubunit potassium/proton antiporter, PhaD subunit (Pseudomonas syringae pv. syringae B728a)
MSWMNQLIIAPILLPLLTAGLMLWLGEKHRPLKGRINLFSSILGLGISVALFLWVQHSGS
SGSIGVYLPGNWGVPFGIVLVVDHLSAMMLVLTGIVGVCALLFALARWDRAGASFHALFQ
IQLMGLYGAFLTADLFNLFVFFEVLLAASYGLMLHGSGRARVSTGLHYISINLLASSLFL
IGAALIYGVTGTLNFADLAIKILQVAESDLGLLHAGAAILATAFLAKAGMWPLNFWLVPA
YSAASAPVAAMFAIMTKVGVYTLLRLWTLLFSGQAGASAFFGGDWLIYGGMATIFTAAIA
IIAAQRLERLASLSILVSAGILLSAVGFAQPSLTSGALFYMVSSTLALSAMFLLGELIER
SRSANEIPLEYDVDQLPRTLESLHPPPGANLDDEQKVVVGQVIPMTMAFLGLSFIACALL
IIGMPPLSGFIGKLTLISALMNPLGLDVAKDEALSTQAWMLIGLLIFSGLASLIAFSRLG
TQRFWTPHERPSPMLRRNECLPIIILLGLCIALTFKAEPLLRYTQDTAAALHEPKQYVQS
VLATRPIPGPTSQQADPEEQP