Protein Info for Psyr_3234 in Pseudomonas syringae pv. syringae B728a

Annotation: Lysine exporter protein (LYSE/YGGA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details PF01810: LysE" amino acids 17 to 192 (176 residues), 67.4 bits, see alignment E=6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3234)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRF6 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psyr_3234 Lysine exporter protein (LYSE/YGGA) (Pseudomonas syringae pv. syringae B728a)
MVLSFDLLLAFTLFAFVTSITPGPNNMMLLASGVNFGFSRTLPHMLGISVGFFVLVLAVG
FGLGSVFKAWPVLYTILRYVGAAYLLYLAWKIATSGPASDSLDSEGKPLSFMSAALFQWV
NPKAWIMAIGAISTYTPMQGYFYNVVVISAVFALINLPSVGVWAGFGSLLRNVLRDPLGL
RIFNGVMAALLVASLYPLFIEH