Protein Info for Psyr_3232 in Pseudomonas syringae pv. syringae B728a

Annotation: Polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02563: Poly_export" amino acids 74 to 156 (83 residues), 69.7 bits, see alignment E=3e-23 PF22461: SLBB_2" amino acids 162 to 239 (78 residues), 34 bits, see alignment E=3.9e-12 amino acids 247 to 332 (86 residues), 66.5 bits, see alignment E=2.7e-22 PF10531: SLBB" amino acids 247 to 294 (48 residues), 29.3 bits, see alignment 8.9e-11

Best Hits

Swiss-Prot: 34% identical to GFCE_SHIFL: Putative polysaccharide export protein GfcE (gfcE) from Shigella flexneri

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to psb:Psyr_3232)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRF8 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Psyr_3232 Polysaccharide export protein (Pseudomonas syringae pv. syringae B728a)
MNRSITALLLVSLALQGCAFAPGQHMTPDDVTLDTPDEPRAQLIEVTPKTLQQQQLRATA
EAKALPQVLLDYRTPEYVIGAGDTLLVTVFEHPELTAPGSQDQLDANTREVLNDGTLYFP
YVGRIRASGRTVSEVREQLRMGLAPQYTEVKVDVKVLRYNSQRILLSGSFKVPGPQPITN
IPLSLVQAVSVAGVDLTDANLAGLTLRREGKDYLIDIDSLNRRDSQLSRIFLKDGDYLHL
NSNSRNKIYVLGEVRNPQVISFGTTRLTLLEALGNSGGLSPDSADGDAVYVIRGAEDFAQ
APSTVYHLNAKKPTAYLLAGQFELKAQDVVFVGPADITRWSRFISQLLGSASVIQTGAAF
RN