Protein Info for Psyr_3191 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF489

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF04356: DUF489" amino acids 6 to 198 (193 residues), 240.6 bits, see alignment E=7.2e-76

Best Hits

Swiss-Prot: 100% identical to HFLD_PSEU2: High frequency lysogenization protein HflD homolog (hflD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 100% identity to psb:Psyr_3191)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRJ9 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Psyr_3191 Protein of unknown function DUF489 (Pseudomonas syringae pv. syringae B728a)
MSPTQEQLIALGGVFQAAVLVDRIAKTGQISEAALSCMLGSLLVVDPKDTLDVYGGDDLN
LHEGYRAMASALERDPATLQREPLRYALSMLGLERQLAKRDDLLEVIGKRIPVIQSQVEH
FGIAHENVIAATGALYQDTLSTLRQRIQVQGDMRNLQQPNNASKIRGILLAGIRSARLWR
QVGGHRWQLVFSRRKLLKELYPLLHG