Protein Info for Psyr_3163 in Pseudomonas syringae pv. syringae B728a

Annotation: epralysin, Metallo peptidase, MEROPS family M10B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00413: Peptidase_M10" amino acids 100 to 196 (97 residues), 29.2 bits, see alignment E=2.4e-10 PF13688: Reprolysin_5" amino acids 126 to 229 (104 residues), 31 bits, see alignment E=9.3e-11 PF13583: Reprolysin_4" amino acids 169 to 228 (60 residues), 28.6 bits, see alignment E=3.2e-10 PF08548: Peptidase_M10_C" amino acids 258 to 476 (219 residues), 278.1 bits, see alignment E=1.2e-86 PF00353: HemolysinCabind" amino acids 343 to 377 (35 residues), 32.4 bits, see alignment 2.2e-11 amino acids 361 to 393 (33 residues), 28.7 bits, see alignment (E = 3.1e-10)

Best Hits

Swiss-Prot: 72% identical to APRA_PSEE4: Metalloprotease AprA (aprA) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K01406, serralysin [EC: 3.4.24.40] (inferred from 100% identity to psb:Psyr_3163)

Predicted SEED Role

"Secreted alkaline metalloproteinase (EC 3.4.24.-), PrtA/B/C/G homolog" in subsystem Protein secretion by ABC-type exporters (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.- or 3.4.24.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRM7 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Psyr_3163 epralysin, Metallo peptidase, MEROPS family M10B (Pseudomonas syringae pv. syringae B728a)
MTKVKENAAIQLSAATSTSFDQINAFAHQYDRGGNLTINGKPSYSVDQAADYILRDDASW
TDRDGNGTINLTYTFLTAKPAGFDNSLGTFSAFNAQQKAQAVLSMQSWADVAKVSFTQAA
SGGDGHMTFGNYSNGSAGGAAFAYLPSGNSRTDGQSWYLVDNSYKVNTTPDNGNYGRQTL
THEIGHTLGLSHPGDYNAGEGNPSYKDATYAEDTRGYSVMSYWSESNTDQNFVKGGAPSY
SSAPLLDDITAVQQLYGANMSTRAGDTVYGFNSTAGRDFYSATSASSKVVFSVWDGGGKD
TLDFSGFTQNQKINLNAASFSDVGGMVGNVSIAKGVVVENALGGSGNDLLIGNAAANDLK
GGAGNDIIYGGGGADSLTGGAGADIFVFGASSDSNRAGQDTIRDFVSGQDKIDVSAISTL
SALQFVNAFSGHAGEAILNYNQSSNLGSLAIDFTGQGIGDFLVGTVGQALATDIVV