Protein Info for Psyr_3149 in Pseudomonas syringae pv. syringae B728a

Annotation: General secretion pathway protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details PF07963: N_methyl" amino acids 12 to 36 (25 residues), 31.7 bits, see alignment 8.1e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 14 to 37 (24 residues), 28 bits, see alignment 1.4e-10 TIGR01710: type II secretion system protein G" amino acids 16 to 143 (128 residues), 96.3 bits, see alignment E=1.5e-31 PF08334: T2SSG" amino acids 40 to 142 (103 residues), 101.8 bits, see alignment E=2.2e-33

Best Hits

Swiss-Prot: 47% identical to GSPG_XANCP: Type II secretion system protein G (xpsG) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 99% identity to psp:PSPPH_3062)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRP1 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Psyr_3149 General secretion pathway protein G (Pseudomonas syringae pv. syringae B728a)
MTFSRTRFKPARRQGGFTLLEMLAVIVLLGIVATIVVRQVGGNVDKGKYGAGKAQLASLG
MKIESYALDVGSPPKTLQQLTEKPGNASNWNGPYAKPSDLKDPFGHAFGYRFPGQHGSFD
LIFYGQDGQPGGEGYSADLGNWE