Protein Info for Psyr_3143 in Pseudomonas syringae pv. syringae B728a

Annotation: general secretion pathway protein M, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF10741: T2SSM_b" amino acids 78 to 192 (115 residues), 99.6 bits, see alignment E=4.9e-33

Best Hits

KEGG orthology group: K02462, general secretion pathway protein M (inferred from 100% identity to psb:Psyr_3143)

Predicted SEED Role

"General secretion pathway protein M"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRP7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psyr_3143 general secretion pathway protein M, putative (Pseudomonas syringae pv. syringae B728a)
MRRPLTSRERRGAALMILALVLCLAYWLLIDSWFAGPLRDINEQTDQLREQQQRYAGLLQ
QGDSLREQLEQARRDPASSTSLLPGEDPSAVAADLMQRIADLISSQASTGGGCELTQRMP
ITPEQDSAEPYRQVKVSLTLNCAIEPLTAILHALEYQRPFLFIDEMSMRRDANAPASGAA
GKLVVHLLVRGYLQPASAGEGEQ