Protein Info for Psyr_3112 in Pseudomonas syringae pv. syringae B728a

Annotation: Putative ammonia monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 18 to 173 (156 residues), 139.3 bits, see alignment E=4.9e-45 amino acids 199 to 350 (152 residues), 136.7 bits, see alignment E=3e-44 PF05145: AbrB" amino acids 42 to 350 (309 residues), 306.5 bits, see alignment E=8.9e-96

Best Hits

Swiss-Prot: 42% identical to ABRB_ECOLI: Putative regulator AbrB (abrB) from Escherichia coli (strain K12)

KEGG orthology group: K07120, (no description) (inferred from 100% identity to psb:Psyr_3112)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRS8 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Psyr_3112 Putative ammonia monooxygenase (Pseudomonas syringae pv. syringae B728a)
MSNASRFSLSSLSPLTQWAGLILIAGIAGQLLKLFDMPAAMFLGPMLVAIGFGVSGASIR
MPKRAFQLGQGTVGVLIAHAMSVSVLLTALHSWHVMLLATILTVVLSAAVGLVLVRFAGI
PSNTAAWGTSPGAASAMVAMSEDYGADSRIVATMQYVRVVCVVTIGALVSHFIGIPDSAA
ALHSSAAALPSLNVVDLALSLAVIVAGVAVGSRLPAGALLVPLMLGGALQLSGVMQITVP
AWLLPIAYGAIGCYVGLRFDRPTVQYVWRRLPMMILASLLLIVLCAVSAWLIAVMMGKDY
LSVYLATSPGGLDTMAIIAIDTHADVGFVLAMQTLRLFGVILTGSFLARQIIRLTDKRIP
AL