Protein Info for Psyr_3064 in Pseudomonas syringae pv. syringae B728a

Annotation: luciferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 84 to 106 (23 residues), see Phobius details TIGR03571: luciferase-type oxidoreductase, BA3436 family" amino acids 14 to 317 (304 residues), 395.9 bits, see alignment E=5.8e-123 PF00296: Bac_luciferase" amino acids 26 to 239 (214 residues), 110.7 bits, see alignment E=4.9e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3064)

Predicted SEED Role

"Coenzyme F420-dependent oxidoreductase" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRX4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Psyr_3064 luciferase (Pseudomonas syringae pv. syringae B728a)
MSPYEIPGAKRHPAFAKVFAPGHLTFGLIAPLEGYPDSAAPTMKDHLALAIQADKAGFAA
LWLRDVPLLDPGFGDAGQVFDPFVYAALLSAVTRQICIGTAGIILTLRNPLMVAKQACSV
DVLLEGRFLLGVSTGDRPGEYPAFGERFETRAERFRDGVELLHAVTEQSFPVFKSRHYGQ
LNGTLDLLPKPVFGRLPMLAIGRCQQDITWLANNMDGWIWHQSGFDTLPEVINHWRSANE
QMQFKPYGYATFFDLDENKDAPMKVGRGISTGRNALIALWQRQREQGVSHVALNLKPLRR
PATEVLQELEEYVLPYFPTRRGDHA