Protein Info for Psyr_3037 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 17 to 43 (27 residues), see Phobius details amino acids 50 to 78 (29 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 352 to 378 (27 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details PF01554: MatE" amino acids 24 to 177 (154 residues), 44.1 bits, see alignment E=9.1e-16 amino acids 243 to 388 (146 residues), 36.1 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3037)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS01 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Psyr_3037 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MAQASARFTQGSVARHIVVTASASALSLFAVFLVDILTLVYVSMLHDPVLLAAVGIAKVL
MFFNGALATGLIIAGASVLSARIGHRAARSIPRLTGSLMLMVITVSGLAAAAQLTFIVPI
TRWLGAEAATYEAARSFIWLTLPFTALQAVMQMSAQMLRTIGDNRRAMGVVLSAAATLAV
ADPFFIFALGLGLDGAGIAFAVSAAVSASIGLYWVRSRIGIVFTRNLKLLRLHARHTFRL
ALPAMAANLATPVGLAYLVASLSAFGTSALAAMTVLDRVIQFSYCAFFALPGALAPVLGQ
NIGASRDDRVRSAVVFTRRLVVCYGLAVWLVLLLCGGMIADLYQLGDEARAVFMAFCLWG
GGLWVLIGLDFVAIAVFLTMNRSWWVAVFAWLRATAGTVPFVFAGTHWFGSSGALPGMFT
GNALIALISITTASLTAKRFFTSRAPVMSIGAH