Protein Info for Psyr_3014 in Pseudomonas syringae pv. syringae B728a

Annotation: protoporphyrin IX magnesium-chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF07728: AAA_5" amino acids 40 to 170 (131 residues), 50.8 bits, see alignment E=4.5e-17 PF00158: Sigma54_activat" amino acids 41 to 152 (112 residues), 21.9 bits, see alignment E=3.1e-08 PF00493: MCM" amino acids 41 to 163 (123 residues), 30.5 bits, see alignment E=4.9e-11 PF01078: Mg_chelatase" amino acids 87 to 158 (72 residues), 25.5 bits, see alignment E=2e-09 PF17863: AAA_lid_2" amino acids 235 to 301 (67 residues), 64.5 bits, see alignment E=1.5e-21

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 100% identity to psb:Psyr_3014)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS24 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Psyr_3014 protoporphyrin IX magnesium-chelatase (Pseudomonas syringae pv. syringae B728a)
MTVSDSTMSETPHFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLAD
VLASGQFVTLPLGATEERLVGTLDLDAALSEGRARFSPGVLAKADGGVLYVDEVNLLADH
LVDLLLDVAASGVNLVERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGLNVALSGHT
LPAERSQIIRRRLDFDSDPQGFCQHWQTQQDALKQRCEQARQLLSGIELDDQSLAMITER
CFAAGVDGMRADLVWLRAARAHAAWRGAGHIEEQDIEAVAEFALRHRRREPLPPPQNSEA
PPPPPGSSSKQAEPESGQGNWGELPAQAVTTGSRREVPSWPKKP