Protein Info for Psyr_3000 in Pseudomonas syringae pv. syringae B728a

Annotation: methyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF05401: NodS" amino acids 13 to 168 (156 residues), 52.8 bits, see alignment E=1.5e-17 PF13489: Methyltransf_23" amino acids 24 to 187 (164 residues), 33.3 bits, see alignment E=1.2e-11 PF05175: MTS" amino acids 33 to 141 (109 residues), 29.4 bits, see alignment E=1.8e-10 PF13649: Methyltransf_25" amino acids 46 to 138 (93 residues), 41.9 bits, see alignment E=4e-14 PF08241: Methyltransf_11" amino acids 48 to 141 (94 residues), 35.6 bits, see alignment E=3.7e-12 PF08242: Methyltransf_12" amino acids 49 to 140 (92 residues), 37.3 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3000)

Predicted SEED Role

"Methyltransferase type 12"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS38 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Psyr_3000 methyltransferase, putative (Pseudomonas syringae pv. syringae B728a)
MSVEDSYFNELFLNNDDPWAFKQRWYERRKRALTLAALPRERYRSVFEPGCANGELSADL
AGRCDSLVCCDTSNLAVDLARKRLADLPHARVLQARLPQQWPQGEFDLIVFSEMGYYLDA
DDLHGLIDRALAALTPDGQLLACHWRPDIEGCPLNAEAVHDILAARLSMHRLFSHHEQDF
LLDLWSRDGTSVAEQEFSDDRHSDPGAQ