Protein Info for Psyr_2992 in Pseudomonas syringae pv. syringae B728a

Annotation: Starch (bacterial glycogen) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 55 to 520 (466 residues), 480.9 bits, see alignment E=2e-148 PF08323: Glyco_transf_5" amino acids 55 to 289 (235 residues), 237.9 bits, see alignment E=3.4e-74 PF13579: Glyco_trans_4_4" amino acids 70 to 276 (207 residues), 31.1 bits, see alignment E=7.4e-11 PF00534: Glycos_transf_1" amino acids 344 to 484 (141 residues), 65.6 bits, see alignment E=1e-21 PF13692: Glyco_trans_1_4" amino acids 347 to 483 (137 residues), 58 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 100% identical to GLGA_PSEU2: Glycogen synthase (glgA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to psb:Psyr_2992)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS46 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Psyr_2992 Starch (bacterial glycogen) synthase (Pseudomonas syringae pv. syringae B728a)
MISAAVKTQKGESFNQPVGELTHLPVFSTKSVPVLQMPTSTVQPQPTMSQVNRRKVLFVT
SELADLVKTGGLGDVSAALPRAMRHLHDVRVLIPGYPQVINSGNPIHIISQLGGHAALPP
CKVGRMDMKDGLVIYVLICPELYEREGTPYADSNGRDWSDNHIRFARLGLAAAEFAAGEV
KSQWCPELVHAHDWPAGLAPAYMRWRGQSTPSIFTVHNLAYQGTVSTASSRELGIPDSAI
TPEGMEFYGQLSFIKAGMAFASHITTVSATYAREITTPEFGCGLEGFLQSKANKGQLSGI
PNGIDESWDAATDEHLICHFAPNEWTRKEINADYVRELFELDASTGPLFAVVSRLVYQKG
LDLTIGVAEHIVNNGGQIAIIGRGEPEEEEAMRELAARFPGRVGVRIGFNETDARRMFAG
SDFLLMPSRYEPCGLSQMYAQRFGSLPVARNTGGLADTIEDGVTGFLFNESTVESYTQAL
DRAFQVFAHPELLNAMRCRAMAAPFNWHQAVEPYADLYRDLLKKNVSVSSNY