Protein Info for Psyr_2970 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat protein:TPR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details PF14559: TPR_19" amino acids 171 to 215 (45 residues), 25.4 bits, see alignment 7.2e-09 amino acids 202 to 262 (61 residues), 31.4 bits, see alignment E=1e-10 PF13432: TPR_16" amino acids 171 to 221 (51 residues), 27 bits, see alignment 2.6e-09 PF13428: TPR_14" amino acids 190 to 230 (41 residues), 26.5 bits, see alignment 3.3e-09 PF13181: TPR_8" amino acids 190 to 220 (31 residues), 20.6 bits, see alignment (E = 1.8e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2970)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS68 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psyr_2970 TPR repeat protein:TPR repeat protein (Pseudomonas syringae pv. syringae B728a)
MPRLSTTGLSPQPTSRRRWLIGAAAAALLVLSLVFWWWRMPVQTAPAKLSHTYAQALEQA
HDGKPGAARVLYQQLARTDLSDAQRISLLAELSDYPSPQALKLLDAALSNPSAQVREAAI
DVSVRLVSNSQRSLLLGPLLDDAEQSVRFRATGALLGLSPDELGLYFAVLQQSAEAFQES
LKSQPQNAQNQLQLARLYLQTGDLEPALAALQRATALDPGNIEAALAHIELLDRKGQAEQ
ARGLFAQLLEHNPGSSLLQHALGMWLLNHGQAEFAVLSLAKATELAPDNNDYRYDLAVAL
HSLNELEAAQRQLTQIVQNQPANRKARVLLIQYWKENGQLQNVQILLAELEQQNPDDPVL
QQGL