Protein Info for Psyr_2926 in Pseudomonas syringae pv. syringae B728a

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 346 (328 residues), 133 bits, see alignment E=6.5e-43 amino acids 246 to 380 (135 residues), 33.6 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2926)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSB2 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Psyr_2926 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MTTDEKQGKTLPLGALLALAMTGFICIVTETLPAGLLPQIADGLDVSASFAGQMVTVYAL
GSLLAAIPLTIATQSWRRRTVLLVTIIGFLVFNSVTALSSSYGLTLIARFFAGVSAGLAW
SLIAGYARRMVVPQLQGRALAVAMVGTPIALSLGVPLGTWLGGFMGWRMAFGLMSGMTVL
LIIWVLVKVPDYPGKSSSQRMALRQVFFTPGVRSVLGVVFTWMLAHNLLYTYVAPFVSAA
GLANDVDLVLLAFGVAALAGIWVTGRLVDRHLRKTVLASLATFAAVSVFFGVFSGSATAI
YIGAFIWGLTFGGAATLLQTALADSAGAGADVALSMNVVVWNSAIAGGGLLGGVLLGQWG
AGSFPWVLLMLLLLSLVIALRAGAHGFARGSRLDREHVLAG