Protein Info for Psyr_2875 in Pseudomonas syringae pv. syringae B728a

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 321 (272 residues), 96.6 bits, see alignment E=7e-32

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to psb:Psyr_2875)

Predicted SEED Role

"Putative transmembrane sugar transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSG3 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Psyr_2875 monosaccharide ABC transporter membrane protein, CUT2 family (Pseudomonas syringae pv. syringae B728a)
MSALDLSVAQADDPAQRWLVQLAQRGSLLVFLAILLGFAVSAPNFLSLGNISNVFAQSAT
LGILALGLTCVVIGGGSNVVSGGLDLSLAANLGLCAAVYSSLNNAGFDAWQAIGLTLGCG
LLVGAFNGLAVVFLRLPPLLATLASMNLIAGLELVLTQNTVLATDSALLDSLASGVWLGV
PALAWVLLGVATVLWLLIQHSAFGLRLYAIGEYPQAAEAAGLNLRRYVFASYLIAGGCAA
LAAFCSAAFFSGSTTGSGDMLLSVVAIAFLGVVFSRRLTANIPGTLLATLLLGFLINGFQ
LLNISSFWVNGVQGVLILLVVAFSGAFGRREGEQ