Protein Info for Psyr_2867 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 165 to 185 (21 residues), see Phobius details PF00672: HAMP" amino acids 183 to 230 (48 residues), 53.1 bits, see alignment 4.8e-18 PF00512: HisKA" amino acids 239 to 300 (62 residues), 49.2 bits, see alignment E=6.4e-17 PF02518: HATPase_c" amino acids 350 to 458 (109 residues), 97 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_2867)

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSG9 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Psyr_2867 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MKSSISTKLFVAVLASVLSVILIMGLTANWSFARGFLGYLNEQAMQRMSPVLPRLAAAYA
REGSWEFMRDNKDRWFEVMRPEPAQDFAIPGLATPPTSDLTGAVFRIALLDAQKNLVMGF
PGVHDDEFMRPVEVDGNVVGWMAVTPFQSVSEAGGERFQQYQLRASLAMGVLSLLLAVLI
AWWIARTLLDPVKRVAAATHRLAAGEYASRVAVSSNDEVGQLARDFNQLAYTLERNEKMR
REFMADVSHELRTPLSVLRGELEAIEDGVRTLDQASMKSLQGEVGMLSKLVDDLYELSLA
DVGALTYRKVDCDLAELLTNITDMFEERCAARQLHLQLELAGGALPVHADPGRLQQLIGN
LLENSVRYTDAGGTVHVRAALQGDEVRVDVMDSGPGVDPQQLPRLFERFYRGETSRNRAS
GGAGLGLAICHSIALAHGGTLSADHSPTGGLWLTLCLPGHLRP