Protein Info for Psyr_2758 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter:TOBE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 5 to 360 (356 residues), 448 bits, see alignment E=1.3e-138 PF00005: ABC_tran" amino acids 21 to 164 (144 residues), 104.4 bits, see alignment E=1.2e-33 PF03459: TOBE" amino acids 298 to 361 (64 residues), 50.5 bits, see alignment E=2.9e-17

Best Hits

Swiss-Prot: 100% identical to MODC_PSEU2: Molybdenum import ATP-binding protein ModC (modC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to psb:Psyr_2758)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSS5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Psyr_2758 ABC transporter:TOBE (Pseudomonas syringae pv. syringae B728a)
MASPIEVRLQMAYPDFTVRTDLSLPGSGITALFGPSGSGKTTCLRCIAGLEKADQSFIRV
HDEVWQDTEKGIFLAPYKRAIGYVFQEASLFAHLSVRDNLEFGMKRIPRQQRRIQLPQAS
ELLGIDHLLQRNPDKLSGGERQRVGIARALLTSPRLMLLDEPLAALDTRRKSEILPYLER
LHRELDIPMLYVSHAQDEVARLADHLVLLDAGNVLASGPIHETLARLDLPLAMGSDAGVV
IEGTVSAYDQHYQLLTVTLPDSKLSMRVAHAQMQVGTLLRIKVQARDVSLNLQPDYQSSI
LNRLPVTVIEEALADNSAHVLVKLDAGGTPLLARITRYSSDQLNLHRGQSLWAQIKAVAV
LA