Protein Info for Psyr_2685 in Pseudomonas syringae pv. syringae B728a

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 86% identical to OTCC_PSEAE: Ornithine carbamoyltransferase, catabolic (arcB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to psb:Psyr_2685)

MetaCyc: 58% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

superpathway of arginine and polyamine biosynthesis (16/17 steps found)
L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
L-citrulline biosynthesis (7/8 steps found)
L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
L-citrulline degradation (3/3 steps found)
urea cycle (4/5 steps found)
superpathway of L-citrulline metabolism (9/12 steps found)
L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)
L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSZ8 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psyr_2685 ornithine carbamoyltransferase (Pseudomonas syringae pv. syringae B728a)
MAFNMRNRSLLSLMHHTPRELLYLLDLSRDLKRAKYTGTERQHLKGKNIALIFEKTSTRT
RCAFEVAAHDQGAHVTYIDPVSSQIGHKESMKDTARVLGRMFDAIEYRGFAQDIVEELAH
FAGVPVFNGLTAEFHPTQMIADVLTMREHSDKPLHEISYAYLGDARYNMGNSLLMIGAKL
GMDVRIAAPAALWPHTDFIAQCKAFAEESGARITITEDPLQAVKGVDFIHTDIWVSMGEP
VDAWDERIGQLLPYQVNPAMMKASGNPRVKFMHCLPAFHNSETKVGKDIATRYPNLANGV
EVTEEVFESPANIAFEQAENRMHTIKAILVSALADI