Protein Info for Psyr_2673 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF1446

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF07287: AtuA" amino acids 4 to 450 (447 residues), 496.8 bits, see alignment E=2.7e-153

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2673)

Predicted SEED Role

"Protein of unknown function DUF1446"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT10 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Psyr_2673 Protein of unknown function DUF1446 (Pseudomonas syringae pv. syringae B728a)
MKTIRIGSGAGYSGDRIEPAIELAEHGELDYLVFECLAERTIALAQQSRLVDPSAGYDPL
LSERMRRVLPFVGKGTDGTRRRLRIITNMGAANPLGAASEIRRIAAELGLSGLKVAALTG
DDVLAALLQQPDQTLDNGRSLRSLGDRLISANAYLGVEGIIQALRADADVIVTGRVADPS
LFLAAQMFEFGWAEDDWALLGRGTLVGHLLECAGQVSGGYFADPGFKDVPDLDRLGFPLA
EIDAAGNALISKVAGSGGRIDTATCTEQMLYEVHDPAAYLTPDVSADFTHAAFESIARNE
VRVQGADGHARPETLKVSVGFLDGWIGEGQMSYGGPGALARGLLAKDIVLKRLALTGVAC
EDIRAELIGVNALHGSHLGARAEGEPWEVRLRVAARCVDKNDAVRVGNEVETLYTNGPYG
GGGASKSVRQVVAVASLFLPRDAVKLQVHIEDMT