Protein Info for Psyr_2646 in Pseudomonas syringae pv. syringae B728a

Annotation: Radical SAM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 TIGR04269: radical SAM/SPASM domain protein, FxsB family" amino acids 6 to 363 (358 residues), 549.6 bits, see alignment E=3.1e-169 PF04055: Radical_SAM" amino acids 13 to 160 (148 residues), 51 bits, see alignment E=2e-17 PF13353: Fer4_12" amino acids 14 to 149 (136 residues), 23 bits, see alignment E=8.7e-09 TIGR04267: HEXXH motif domain" amino acids 520 to 699 (180 residues), 89.1 bits, see alignment E=4e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2646)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT37 at UniProt or InterPro

Protein Sequence (723 amino acids)

>Psyr_2646 Radical SAM (Pseudomonas syringae pv. syringae B728a)
MDAAKISSFLVKVASRCNLDCDYCYVYHHADQSWRSMPKFLSAEHREAFARQLAQYVTQT
DLKQCAVILHGGEPLLAGVQTLADFAILLRSTCPILVDVSLQTNGLLLTDEALQILAAAD
IGVSLSLDGPKIANDKHRLTRKGRSSFEQTQQALIRLQNYPSVFAGVIAVVDTSTSASEL
FSYFDQFKIPRLDFLLPDAHWLRPPPGRNQDPGLYEQWLVNAFDVWFDEYPHIPLRTFEA
LLDVCAGLPSGTDAFGFGDVSLLSIETDGTYHDLDVLKVTQDGATRLIGSVLDTPIAEVA
QSQAIEQHRRYLRKEGLSEACQSCGIVDICGGGSLPHRFNQEGFVNPTVYCNEMKRLVAH
ITERLNVHLNEGWQGEEQIPLPETFDLAEFELAETSAVHLQWLCAGADVDAVHGLHKALD
LYPDDPRAMQLRSLDDASFALKAQQPGAIAWAGAALAQSRGHALLAVDGQPITAVSDYLA
RILNDEAQHDCDGFLVAEDDLWLRAPFGTSICFEDEGLAAKGRGLVRQALNIVKAWRPEL
AAEMQLACSAIQFIRDPSADPRKIVSFSDNSVPGALYVSISQGDRLIDPYDLADSVIHEH
RHQKLYLLERYAATVEHTSAQVVSPWREDLRPPSGLLHAVFVFVELRRFWLHVRDHGPAE
MNSRAINQIADTDLHLEQAFETLKECPLTEVGQHLVKVLRIASTEGITTDEFAAYRPAVQ
PVG