Protein Info for Psyr_2618 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter:Protein of unknown function DUF214

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 252 to 271 (20 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 526 to 553 (28 residues), see Phobius details amino acids 577 to 606 (30 residues), see Phobius details amino acids 612 to 636 (25 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 113.5 bits, see alignment E=1.9e-36 PF12704: MacB_PCD" amino acids 277 to 496 (220 residues), 153.1 bits, see alignment E=1.9e-48 PF02687: FtsX" amino acids 532 to 646 (115 residues), 70.3 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 100% identical to MACB2_PSEU2: Macrolide export ATP-binding/permease protein MacB 2 (macB2) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to psb:Psyr_2618)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT65 at UniProt or InterPro

Protein Sequence (653 amino acids)

>Psyr_2618 ABC transporter:Protein of unknown function DUF214 (Pseudomonas syringae pv. syringae B728a)
MSRALLELNGVTRRFVAGEKDFIALNDINLTINAGELVAITGASGSGKSTLMNVLGCLDH
PNSGSYKVDGRETGTLTDDELAELRRDHFGFIFQRYHLLPHLAAIQNVEMPAIYAGTGKG
MRVERAQKLLERLGLSGHLEHRPSQLSGGQQQRVSIARALMNGGEIILADEPTGALDSVS
GKEVMNILLELNSAGHTVILVTHDEKVAAHAERIIEMRDGEIIADRVNTDRPIINEKTTE
RLPTKPRQGNRLMANIGLFQEAFVMAWVALISHRMRTLLTMLGIIIGITSVVSIVAIGEG
AKRYVLKDIQAIGSNTIEVFPGSDFGDTKSMDIQTLALSDVAALSSEYYIDSATPNIGRN
LLVRYRNIDVSATVSGVSPSYFQVRGTKMGLGVGFNKDDARRQAQVVVIDHNTRIRLFGP
KVDPLGQVILVGNLPCTVIGVTENKKNIFDTSKNLNIWMPYETASGRLLGQTYLDGITVR
VKDGQPSKVVEDNVNKLLQKRHGTKDFFTYNLDSVMQTVQKTSQSLALLLSLIAVISLAV
GGIGVMNIMLVSVTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLIGGVIGISLSFVIG
YVFSLLVKEWQMVFSLGSIVTAFICSTLIGIVFGFVPARNAAQLDPIEALARD