Protein Info for Psyr_2534 in Pseudomonas syringae pv. syringae B728a

Annotation: Carboxymethylenebutenolidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details PF23678: YqhI" amino acids 1 to 35 (35 residues), 69.5 bits, see alignment 3.5e-23 PF01738: DLH" amino acids 84 to 294 (211 residues), 172.4 bits, see alignment E=3.2e-54 PF02129: Peptidase_S15" amino acids 88 to 207 (120 residues), 35.2 bits, see alignment E=3.4e-12 PF08840: BAAT_C" amino acids 163 to 228 (66 residues), 24.4 bits, see alignment E=8.2e-09 PF00326: Peptidase_S9" amino acids 215 to 283 (69 residues), 25.2 bits, see alignment E=3.2e-09

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 100% identity to psb:Psyr_2534)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTE9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psyr_2534 Carboxymethylenebutenolidase (Pseudomonas syringae pv. syringae B728a)
MERLTAKDFAPELLELYDYYAHGRINRREFLDRAALFTFGGMTASALLASLSPNYALAEQ
VEFTDPDIIAEYVSYPSPNGHGQVRGYLVRPAKATGKVPAVVVAHENRGLNPYIEDVARR
VAKAGFIALAPDGLSSVGGYPGNDDKGRELQQTVNPEKLMNDFFAAIEWLMKHDATTGKV
GITGFCYGGGVANAAAVAYPELGAAVSFYGRQPNAEDVVKIKAPVMIHYGELDTRINEGW
PAYEKALKAAGKTYETYIYPGANHGFHNDSTPRYDEAAAKLAWDRTLGWFNKYLV