Protein Info for Psyr_2530 in Pseudomonas syringae pv. syringae B728a

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 229 (209 residues), 71.7 bits, see alignment E=5.8e-24 PF07690: MFS_1" amino acids 31 to 385 (355 residues), 107.7 bits, see alignment E=6.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2530)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTF3 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Psyr_2530 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSTLQSSASRPHEQKARRAVVATVIGNGLEWFDFTVYSFFSVIIAKVFFPTGSELTSYLL
ALATFGVGFFMRPVGGIVLGIYSDKRGRKAALSLTILLMALGTLIIGLTPGFAQIGYLAP
LLIVLARLLQGFSAGGEMGSATAFLTEHAPEGRKAFYSSWIQASIGVAVLLGSALGAVLS
SYLTQAQLESWGWRVPFLIGTLIGPVGFYIRSRVDETPAYKAAKPVESPLREVIKTYPRQ
TLISFSLVVLWTVCTYAILFYIPSYAQRVLGLPSWMGFSAGMMGGAVLIVATPIVGALAD
RSGHRPWLLGSAIAIFLSAYPMFLFINQMPGLFSLLIFELVLGLLISAYIGSILAAFGEL
LPTHVLSTGLSVAYNFAVTLFGGFATFTITWLIASTGSNLAPAFYIMFAALVSGIGALLY
RDRAPAAHHPLSGAYP