Protein Info for Psyr_2495 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 75 bits, see alignment E=3.3e-24 amino acids 336 to 465 (130 residues), 77.4 bits, see alignment E=6.1e-25 PF12848: ABC_tran_Xtn" amino acids 224 to 298 (75 residues), 72 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 74% identical to YBIT_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbiT (ybiT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2495)

Predicted SEED Role

"ABC transporter ATP-binding protein uup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTI8 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Psyr_2495 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MISTANITMQFGPKPLFENVSVKFGAGNRYGLIGANGCGKSTFMKILGGDLEPSGGQVML
EPNVRLGKLRQDQFAYEEFTVLDTVIMGHEELWKVKAERDRIYSLPEMSEDDGMAVAELE
TEFAEMDGYTAESRAGELLLGLGIGIEQHNGPMSEVSPGWKLRVLLAQALFSDPEVLLLD
EPTNHLDINTIRWLENILTQRNSLMIIISHDRHFLNSVCTHMADLDYGELCLFPGNYDEY
MTVATQSREQLLSDNAKKKAQISELQSFVSRFSANASKAKQATSRAKAIDKIQLAEVKPS
SRVSPFIRFEQTKKLHRQAVIVDRMAKGFDGKTLFKDFSFQVEAGERVAIIGPNGIGKTT
LLRTLVNELQADAGTVKWTDAAEIGYYAQDHAHDFEDDSTLFDWMGQWTQGGEQLVRGTL
GRMLFSNDEILKSVKVISGGEQGRMLFGKLILQKPNVLVMDEPTNHLDMESIESLNLALE
NYPGTLIFVSHDREFVSSLATRIIELSPSGVVDFSGTYDDYLRSQGVTF