Protein Info for Psyr_2465 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 310 (307 residues), 106.3 bits, see alignment E=8.7e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2465)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTL8 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psyr_2465 Acyltransferase 3 (Pseudomonas syringae pv. syringae B728a)
MLISVQALRAFAAWVVVCHHFMQIFFDFKASGPVGQFFVSKGAVGVDIFFVISGLVIFLS
TQNSDMPARRFILHRLIRIVPAYWLYTAAMGLLLLIAAPMLPHQVIGWQNFLLSLVFIPS
ENPGGYGLYPTLNVGWTLNYEMFFYLLFSMVFLFQQRHRPLIIAAALFAVSEVLARAGLI
SRFYGNDIIYEFLLGIGIGILYRRGWIKQALWLPLAGIAVGLYAINNLSNEQRLLNWGLP
SALIVLSCISLEPYFQGNRLLKVLGDCSYSVYLLHVLVLYGGLLMAQRFGLNPYVVFAFC
VPIIAIGAWVSYEWIEKGLYRRMKAWLDARRAVSQAQALT