Protein Info for Psyr_2454 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF81

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 213 to 243 (31 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF01925: TauE" amino acids 36 to 271 (236 residues), 170.5 bits, see alignment E=2.4e-54

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to psb:Psyr_2454)

Predicted SEED Role

"FIG011065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTM9 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psyr_2454 Protein of unknown function DUF81 (Pseudomonas syringae pv. syringae B728a)
MRHVRAVILPLCRPRHKPSATMPFELSVDLTTLAILAVVAFIAGFIDAIAGGGGLLTTPA
LMTAGLPPHLVLGTNKLSSTFGSATASFTFYRRKLFDPRQWLHAVVGTAVGAALGAVIAH
YLPAEWLNQMLPVIVFGCGLYLLFGGTPKAPLDSNAPIRKKWQLPQGLGLGFYDGVAGPG
TGAFWTVSTLLLYPVDLVKASGVARSMNFVSNAVALSVFIFSGQVDYIIGLSMGLAVMLG
AYFGAGTAIKGGAKFIRPVFITVVLGLTVRLAWQHWFGGA