Protein Info for Psyr_2421 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 318 (310 residues), 118.8 bits, see alignment E=1.3e-38 amino acids 208 to 381 (174 residues), 46.3 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2421)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTR2 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Psyr_2421 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MLLPILLLSAAGFTVLTTEFVIVGLLPAVARDLNVTVSQAGLLVTLFAFTVAAFGPFLTA
YFSRFERKRLFVSILVLFGFANVLAALAPNIAVMGIARLIPALGLPVFWALASETAVDIV
GPQFAGRAIARIGFGIVCATVFGIPIGTLISDAFGWRTAFLVLAALAFAKALLLTVYLPK
TAARQNPVSILKQFGILRSRMMQGHVLLSVLVFSGMFTAYTYLADMLERLAGFDGALVGW
CLMGFGAVGLLGNSLGGRMVDRHPLIASLVFCAFMVVGMVAVVPSIHSVVALSLALAVWG
ITQAALFLVSHVRLIKAAPQAPAFAASLNIAGANLGIGIGAVIGGRVIDHLGLGNVGFAA
AGIIVLAIVLALLLIKRDPGPLPA