Protein Info for Psyr_2365 in Pseudomonas syringae pv. syringae B728a

Annotation: Radical SAM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR03916: putative DNA modification/repair radical SAM protein" amino acids 4 to 398 (395 residues), 537.5 bits, see alignment E=1.3e-165 PF04055: Radical_SAM" amino acids 61 to 193 (133 residues), 31.7 bits, see alignment E=8.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2365)

Predicted SEED Role

"Biotin synthase related domain containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTW8 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Psyr_2365 Radical SAM (Pseudomonas syringae pv. syringae B728a)
MQLIDKLSILADAAKYDASCASSGAPKRSSQDKSGLGSTNGMGICHSYTPDGRCVSLLKI
LLTNFCLYDCQYCVNRRSSDVPRARFTPEEVVTLTLDFYRRNCVSGLFLSSGIIRSADYT
MEQLVEVARLLREVHEFRGYIHLKTIPDADPALIEKAGRYADRLSVNIELPTDLSLQTLA
PEKDVASIKQAMQTIYTGEQTVRNEPRSPRFAPAGQSTQMIVGADATDDSTILHSAQSLY
SNFKLRRVYYSAFSPIPNSPNSVPLAAPPLMREHRLYQADFLLRGYGFTAGELLDGPGDL
ALDIDPKLAWALGNRQVFPLDLNQADPALIARVPGIGIRTTQRLVELRRQRRIRYEDLTR
MRCILAKAKPFIITSDYHPPHAETTSEFLHHQLRDRPQPQQMGLWG