Protein Info for Psyr_2334 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 208 to 233 (26 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 274 (178 residues), 28.7 bits, see alignment E=5.2e-11

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to psp:PSPPH_2834)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTZ8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psyr_2334 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MSLLSEMRQGGRGYWLSAPALALYIGLLVLPLGLTLVLSFNVFDYQVGVKSDSYTLANYV
AVVTDSYFYEIFLRTFWISALVTLLCVLIGVPEAYILSRMGTPWRSIFLILILTPLLISV
VVRAFGWSLLLGADGLINQVIQFMGGRPVKLLYTPFAVVIALVHVMLPFMIIPVWTSLQK
LDPTAEQAALSLGASQAKVMRLIVLPQVMPGVLSGSLIVFGLAASSFAIPGLLGGRRLKM
VATVIYDQYLSELNWPMGATLAVALLLVNLLVMLSWNRMIEGRYKKTLGE