Protein Info for Psyr_2327 in Pseudomonas syringae pv. syringae B728a

Annotation: GTP cyclohydrolase subunit MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 6 to 332 (327 residues), 371.9 bits, see alignment E=1.3e-115 PF04055: Radical_SAM" amino acids 19 to 180 (162 residues), 126.8 bits, see alignment E=1.5e-40 PF13353: Fer4_12" amino acids 24 to 111 (88 residues), 26.3 bits, see alignment E=1.2e-09 PF06463: Mob_synth_C" amino acids 186 to 314 (129 residues), 129.9 bits, see alignment E=8.6e-42

Best Hits

Swiss-Prot: 100% identical to MOAA_PSEU2: GTP 3',8-cyclase (moaA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to psb:Psyr_2327)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU05 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psyr_2327 GTP cyclohydrolase subunit MoaA (Pseudomonas syringae pv. syringae B728a)
MSEPVLMDRFARKVDYLRMSVTDRCDFRCVYCMAEEMTFLPRQQILSLEEILQVAERFVA
LGTRKIRLTGGEPLVRAGVVGLCEKIAALPGLRELCMTTNGSQLDKLAAPLFKAGVTRLN
ISLDSLDPQRFRELTRTGDLHKVIAGIDAANAAGFVHTKLNCVVMHGRNDDEINDLLAFA
IDRNLDVSFIEEMPLGIISEHSRAESFYSSDQVRERIAERYTLVPSTDSTQGPSRYWRLA
EAPGIRIGFISPHSHNFCGTCNRVRMTVEGRLLLCLGNEHSVDLKAVLRANPGQPEKLEK
AIIDAMQLKPWSHNFTHDDGVQVVRFMNMTGG