Protein Info for Psyr_2304 in Pseudomonas syringae pv. syringae B728a

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 349 to 367 (19 residues), see Phobius details amino acids 373 to 390 (18 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 77 to 470 (394 residues), 126.2 bits, see alignment E=1.7e-40 PF07690: MFS_1" amino acids 80 to 330 (251 residues), 70.1 bits, see alignment E=1.6e-23 amino acids 327 to 456 (130 residues), 39.5 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to psb:Psyr_2304)

Predicted SEED Role

"MFS sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU25 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Psyr_2304 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MTSLPHAEAAANEPLRAAYISARIDRLPAVATIWRLVALLSIAGFFELYDLFQTAYISPG
LIRDGIFATGSQGLFGFSDQAAFASATFLGLFFGASLVSPIADRYGRRAIFTFALIWYTV
ATVIMGLQTSALGVIGMRFVVGIGLGVELVTIDTYLSELVPKRIRSSAFAFAFFIQFLSV
PSVALMSWWLVPQDPFGFSGWRWVVISSAVFALFVWWLRSALPESPRWLAQKGRFDEAER
IMDGIEARCIRDHGKPLDEPEPENVALSGNGRFADMWQPPYRRRALMLIVFHVFQAIGFF
GFGNWLPALLSGQGLSVTHSLAYAFVITLAYPLGPLLFVKFANRFENKWQIVGSALGAMI
FGSLFAFQTSAAGLIFCGIMITFCNAWLSFSYHSYQGELFPTNIRARAVGFCYSFSRLST
VFSSLLIGIFLDHFGTPGVLAFIVGSMLIVIVTIGRFGPRTRNLALEQIAHR